DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG33769

DIOPT Version :9

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:170 Identity:57/170 - (33%)
Similarity:99/170 - (58%) Gaps:5/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CVLMVIFVSQAVSSSVTLNRVQCEKNAKFFATLNVTSVNSTIYADIELLQALKAGFRGHVDVQLR 70
            ||::.:.:.|: ...:|.....|..|...|:..::..:.:.:..|:.|:..|:.|.:.|:..:.|
  Fly    13 CVVVTVVIKQS-GPRMTFRAGDCTYNRSTFSNFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEFR 76

  Fly    71 LSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLKGWHVEMGLV 135
            |:.||.:||:.|.|.:||.|:...::|::|||..|:.|..||..:||:..|:|||.||.::...|
  Fly    77 LTKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCPIREGYYYLHGWTLDANNV 141

  Fly   136 PSYLLSGDYLLSALVYYGKYRSKKQMF--LVRCMVEATMH 173
            ||:|..|||.:|...|||::  ||.::  |:.|.|||.::
  Fly   142 PSFLYLGDYRISGSFYYGRF--KKHLYNPLLECSVEAVLN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 37/92 (40%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 37/92 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.