DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG33914

DIOPT Version :9

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:134 Identity:21/134 - (15%)
Similarity:49/134 - (36%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLMVIFVSQAVSSSVTLNRVQCEKN------AKFFATLNVTSVNSTIYADIELLQALKAGFRGHV 65
            :|.::|:::.....:....|.||..      .::.|...::...::|.....:|:.:......:.
  Fly    12 LLCLLFLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYF 76

  Fly    66 DVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRW-----------IKSVSKNSNFMENCPVP 119
            .:..|.|.:      :.|.:::...|.|:|..|.|.|           .:.:..::|....||..
  Fly    77 QLMTRGSES------IHAASNWQPFLHTMKLDLCRFWKNHHNHLARMVFEFIDGHTNMNHTCPYT 135

  Fly   120 AGHY 123
            ...|
  Fly   136 KEKY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 11/59 (19%)
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.