DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG33766

DIOPT Version :9

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster


Alignment Length:180 Identity:46/180 - (25%)
Similarity:81/180 - (45%) Gaps:27/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIVCVLMVIFVSQAVSSSVTLNRVQCEK-NAKFFATLNVTSVNSTIYADIELLQALKAGFRGHV 65
            :.::|:::|    ...::.:.|...||.. |..:|:...:...||.:..:..||:.|..|....:
  Fly    10 MSLICLIIV----PIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMDI 70

  Fly    66 DVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLKGWHV 130
            :..:.:.|:..||.:.|...|.|.||:..::::|::|..:...:.||.:.|||....||||.::.
  Fly    71 EFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135

  Fly   131 EMGLVPSYLLSGDYLLSALVYYGKYRSKKQM-----------FLVRCMVE 169
            ....:|.:|           |.||||.|..|           |||.|..|
  Fly   136 NTLFIPKFL-----------YAGKYRVKFDMNQLRKIDGVRYFLVGCAFE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 30/101 (30%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.