DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG33777

DIOPT Version :9

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:168 Identity:35/168 - (20%)
Similarity:68/168 - (40%) Gaps:30/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVCVLMVIFVSQAVSSSVTLNRVQCEKNAKFFATLN---VTSVNST---IYADIELLQALKA 59
            ::.::.:|..:|:.:..::      ::|......||.::   :.|||.|   :...:.|||...:
  Fly     4 LVYLIQLLFFLFLVEKFTN------IKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVS 62

  Fly    60 GFRGHVDVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKN-SNFMENCP------ 117
            ..:.:.....|.:..|  .||.....|.|:.:...|.:....:|..:.|: ||....||      
  Fly    63 RIKVNAATWKRYNGYK--PSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAI 125

  Fly   118 ---VPAGHYYLKGWHVEMGLVPSYLLSGDYLLSALVYY 152
               :|..  ::......:..||    |||||.|:..|:
  Fly   126 VEKLPIS--FVNNQVTSVLPVP----SGDYLFSSHWYF 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 21/87 (24%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.