DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG33770

DIOPT Version :9

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:169 Identity:57/169 - (33%)
Similarity:94/169 - (55%) Gaps:1/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCVLMVIFVSQAVSSSVTLNRVQCEKNAKFFATLNVTSVNSTIYADIELLQALKAGFRGHVDVQL 69
            :|:.:.:|..:| ..||.....:...|.|:|.....|..|..|:.|:.|.:.|..|:|..:|.:.
  Fly    17 LCLAIALFSIRA-EGSVKFIAGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWRARLDFRT 80

  Fly    70 RLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLKGWHVEMGL 134
            |:.|:|.||||.....|.|.:::..|.:||::|.|::.|..||:..||:.|.||||:.|....||
  Fly    81 RVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYLRDWQFGEGL 145

  Fly   135 VPSYLLSGDYLLSALVYYGKYRSKKQMFLVRCMVEATMH 173
            ||.::.||.|.|....::|||:.|.:.|::.|..:|.::
  Fly   146 VPPFITSGSYRLETYNFFGKYKGKDEDFIMSCTADAIIY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 35/90 (39%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.