DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG33772

DIOPT Version :9

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster


Alignment Length:179 Identity:42/179 - (23%)
Similarity:81/179 - (45%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIVCVLM----VIFVSQAVSSSVTLN-----RVQCEKNAKFFA-----------TLNVT-SVN 44
            ||.|..||:    :..||:.:....|||     ::....|:|:.:           |:|:| ::.
  Fly     1 MLLIRRVLLFGIILCLVSRFLEGQKTLNFLLFRKIVANHNSKYISLYEAAISQDHTTINITLNLA 65

  Fly    45 STIYADIELLQALKAGFRGHVDVQLRLSNAKKFQSLVQADTDYCELLSTLKD-SLFRRWIKSVSK 108
            ..|.||:    .|||.....|.     .:.:.::.:...:.:.|:::...|. ||...|:.::.:
  Fly    66 RNITADV----WLKATIGQRVS-----KSGESYRDVFTYNVNLCQVMGRGKGISLINFWMNNILR 121

  Fly   109 NSNFMENCPVPAGHYYLKGWHVEMGLVPSYLLSGDYLLSALVYYGKYRS 157
            .||...|||:..|:||::....|...:|.::.||.:.:.:.||...:.|
  Fly   122 QSNMPRNCPLREGNYYMRNIRSEKETIPRFIRSGSFRIDSSVYVRDWNS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 20/83 (24%)
CG33772NP_001027146.4 DUF1091 89..182 CDD:301369 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.