DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33768 and CG13193

DIOPT Version :9

Sequence 1:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:149 Identity:41/149 - (27%)
Similarity:71/149 - (47%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSVTLNRVQCEKNAKFFATLNVTSVNSTIYA------DIELLQALKAGFRGHVDVQLRLSNAKKF 77
            |..|...|:|.|:       ..:|:...:.|      ||.|.:.||.|.|..:.:...:....::
  Fly    35 SKFTNISVECSKD-------YCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRY 92

  Fly    78 QSLVQADTDYCELL-STLKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLKGWHVEMGLVPSYLLS 141
            |:|...|.|.|:.| ..|:.||.:.|:::|.|..|..:.||:....|.::.:.:|...:|.||.:
  Fly    93 QTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIPGYLPA 157

  Fly   142 GDYLLSALVYYGKYRSKKQ 160
            |.|.|....||||.:.:::
  Fly   158 GFYRLHDTNYYGKPKGRQR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33768NP_001027142.2 DM8 76..167 CDD:214778 27/86 (31%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.