DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33813 and zgc:153405

DIOPT Version :9

Sequence 1:NP_001027299.1 Gene:His1:CG33813 / 3771838 FlyBaseID:FBgn0053813 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001038843.1 Gene:zgc:153405 / 751661 ZFINID:ZDB-GENE-060825-170 Length:202 Species:Danio rerio


Alignment Length:234 Identity:91/234 - (38%)
Similarity:116/234 - (49%) Gaps:53/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITA- 77
            |||||...||        .|.:|.||..     |..:.::..::...|||.|.||.|:||.::| 
Zfish     7 AAPPAKAPKK--------KAASKPKKTG-----PNVRDLIVKTVTASKERHGVSLAALKKALSAG 58

  Fly    78 TYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQS 142
            .|  |.::....:|..:|:.|:||.|:|.||.||||||||:   ||:.:||              
Zfish    59 GY--DVERNNSRVKTAVKALVLNGTLVQPKGTGASGSFKLN---KKQAEPK-------------- 104

  Fly   143 KKVASKKIGVSSKKTAVGAADKKPKAKK--------AVATKKTAENKKTEK-AKAKDAKKTGIIK 198
            ||.|:||..|.:||.|.    |||.|||        |.|.|.|...||.:| |.||.|.|:....
Zfish   105 KKPAAKKTAVKAKKPAA----KKPAAKKSPKKVKKPAAAKKATKGPKKAKKPAAAKKATKSPKKA 165

  Fly   199 SKPA----ATKAKVTAAKPKAVVAKASKAKPAVSAKPKK 233
            .|||    |||:....||||.|..||:|.|   .|.|||
Zfish   166 KKPAAAKKATKSPKKVAKPKTVKPKAAKPK---KAAPKK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33813NP_001027299.1 Linker_histone 46..118 CDD:278939 29/72 (40%)
zgc:153405NP_001038843.1 Linker_histone 27..97 CDD:278939 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11086
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.