DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33813 and H1-4

DIOPT Version :9

Sequence 1:NP_001027299.1 Gene:His1:CG33813 / 3771838 FlyBaseID:FBgn0053813 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005312.1 Gene:H1-4 / 3008 HGNCID:4718 Length:219 Species:Homo sapiens


Alignment Length:260 Identity:105/260 - (40%)
Similarity:128/260 - (49%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::|.|..|:     ||..||..|:|||..|||...:|||.    ||..:::..::...|||.|
Human     1 MSETAPAAPAA-----PAPAEKTPVKKKARKSAGAAKRKASG----PPVSELITKAVAASKERSG 56

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:   ||....:|
Human    57 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLN---KKAASGEA 116

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKT 194
            |.|              :||.|.:..|...|||.|..||..|...||:|  |||.|...|.|...
Human   117 KPK--------------AKKAGAAKAKKPAGAAKKPKKATGAATPKKSA--KKTPKKAKKPAAAA 165

  Fly   195 GIIKSKPAATKAKVTAAKPKAV---VAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAKK 256
            |   :|.|.:..|..|||||..   .|||...||. :||||        :|..|..|.|..||||
Human   166 G---AKKAKSPKKAKAAKPKKAPKSPAKAKAVKPK-AAKPK--------TAKPKAAKPKKAAAKK 218

  Fly   257  256
            Human   219  218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33813NP_001027299.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H1-4NP_005312.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 21/48 (44%)
H15 34..114 CDD:238028 40/88 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..219 64/158 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10654
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11467
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.