DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG13250

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:183 Identity:38/183 - (20%)
Similarity:72/183 - (39%) Gaps:43/183 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHIVVILVILLMAKWASSKFE--FTNLQCTSFDKSFDDFEYCYI-----RSANRSYKYLTLKVNL 64
            |.:||  .||.....|:..|:  :.::.|:..|.:..:...|.|     :..|....:|.|:.::
  Fly    14 CCLVV--PILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSV 76

  Fly    65 FK----------TPRFNGYRPF--MFNITLDACRFLK-NTDSKPIAKYFYEFFNSYSNLNHSCPF 116
            .|          ..|.:  ||.  :|.|.:|.|..:: .:.|:.:....::...| .|...:|| 
  Fly    77 TKMWVELSVGQIANRKD--RPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNYPDACP- 137

  Fly   117 NHDLIVDKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEID-RAMVKIYYTIS 168
               |:.:      ||:..|.....|:       |:.||..| :...|:.:.:|
  Fly   138 ---LLAN------VNYTSTRFALNPD-------HFPAYMPDMKFNTKLVFQLS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 19/99 (19%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.