DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG13590

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:174 Identity:52/174 - (29%)
Similarity:87/174 - (50%) Gaps:22/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HIVVILVILLMAKWAS----SKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNL---- 64
            |.|.|..:.|:..:.|    ...:.||..|.|::||:....||.:::.:|:...|.:.|..    
  Fly     3 HKVFIFAVSLLVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVEPA 67

  Fly    65 ------FKT-PRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIV 122
                  ||| .:.|||:||:|:.|.|||.|::.. ::|:||..:....:.|.:||:||:....::
  Fly    68 RNISVHFKTMKKANGYKPFLFDYTFDACEFMRRR-NQPVAKIIWYMIRNVSTINHTCPYEGLQML 131

  Fly   123 DKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYT 166
            .    ||  |:|...:|.|.|||||...|:.....:....:|:|
  Fly   132 S----DF--HKVDIPVPLPSGDYLLMVDWLFDGKTQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 32/97 (33%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472401
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.