DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG13589

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:178 Identity:48/178 - (26%)
Similarity:86/178 - (48%) Gaps:22/178 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKNTRCHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRS------------ 54
            :...|...||.:::..:....:...:.||..|.|::||:....||.:::.:|:            
  Fly     1 MNRRRAAFVVSVILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE 65

  Fly    55 -YKYLTLKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNH 118
             .|.:.|.:.:.|  :.|||:||:|:.|.|||.|::.. ::|.||..:....:.|.:||:||:..
  Fly    66 PAKNIYLHMKMMK--KANGYKPFLFDYTFDACEFMRRR-NQPFAKIVWNMIKNVSTVNHTCPYEG 127

  Fly   119 DLIVDKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYT 166
            ..::.    ||  |.:...:|.|.|||||...||.....:....:|:|
  Fly   128 LQMLS----DF--HHIDVPVPLPSGDYLLLLDWIFDFKPQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 29/86 (34%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472391
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.