DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG13561

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:86/174 - (49%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VILLMAKW----ASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------ 68
            :.||...|    .....:|||::|.|.|::|.....|.:.:..|....::|:.|:.:.|      
  Fly     7 LFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSM 71

  Fly    69 ------RFNGYRPFMFNI-TLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVD--K 124
                  :.:||:||::|| ..|.|.:|:.. :.|........|.:.:|:| .||...:::::  :
  Fly    72 RMQLLKKASGYKPFLYNICQSDVCEYLEKR-NHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFR 134

  Fly   125 IPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            .|:     :|.:::|.|.|||.|.|.:..:..:.|.||:|:|::
  Fly   135 FPV-----KVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 25/101 (25%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472399
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.