DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33919

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:145 Identity:35/145 - (24%)
Similarity:62/145 - (42%) Gaps:33/145 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKNTRCHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFK 66
            :.|..||:..|       .|        ||...:.|        |::.....:   ..:::.:|.
  Fly    38 VSNVSCHVKAI-------NW--------NLAVVNMD--------CFMIVPLHN---PIIRMQVFT 76

  Fly    67 TPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVN 131
            ....|.|:||:.::.:..|..::..:..|.....::.|..|:|:||||||:..||.....:|   
  Fly    77 KDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLD--- 138

  Fly   132 HRVTNIL-PFPEGDY 145
               |::| |||:|.|
  Fly   139 ---TSLLPPFPQGFY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 26/87 (30%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.