DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33640

DIOPT Version :10

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:138 Identity:34/138 - (24%)
Similarity:50/138 - (36%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FDKSFDDFEYCYIRSA------NRSYKYLTLKVN-----LFKTPRFNGYRP-----FMFNITLDA 84
            |..:.||.:....:||      ||||....:.:|     |..|...:..||     .::|:.|:.
  Fly    29 FTFTVDDRDLFLSQSAVVEQDGNRSYLSGHMMINRLVNDLTLTSSMDITRPQRPELRLYNVQLNF 93

  Fly    85 CRFLKNTDSKPIAKYFYEFFNSYSNLNHSCP----FNHDLIVDKIPIDFVNHRV---TNILP--F 140
            |..|.|.......:..|..:..:.|....||    ||:.|           ||.   ..:||  .
  Fly    94 CSVLNNGYKNKFIRMLYNNYAQFLNTKPKCPLKPNFNYSL-----------HRAYIDEAMLPDLL 147

  Fly   141 PEGDYLLE 148
            ||..|.|:
  Fly   148 PECTYRLK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 24/105 (23%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 21/91 (23%)

Return to query results.
Submit another query.