DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33690

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:174 Identity:62/174 - (35%)
Similarity:94/174 - (54%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MAKWASSKF------------EFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP-- 68
            |:||...||            .||||.|:|::..|..|..|.|::.||::||:::...|.:.|  
  Fly     1 MSKWLLVKFLLTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIV 65

  Fly    69 ---------RF-NGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVD 123
                     || :||:||:::::.|.|:|:| |....:.|.||..|...:|:||:||::||||||
  Fly    66 DARVTIQFRRFDSGYKPFLYDLSYDGCKFMK-TQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVD 129

  Fly   124 KIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTI 167
            |:....:.......:..|.|||.:.|.|...:|.||.||||..|
  Fly   130 KLFTGNLEEEFGRFIIIPNGDYAIYTDWATNKISRASVKIYLKI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 33/98 (34%)
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472098
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.