DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33914

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:179 Identity:45/179 - (25%)
Similarity:87/179 - (48%) Gaps:25/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTPRF----- 70
            ::|.:|.:.:.......|||:.|.|.|.|....|||.:.:.:::...::|:..:.| |.|     
  Fly    11 LLLCLLFLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLK-PMFTNIEI 74

  Fly    71 ---------------NGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHD- 119
                           :.::||:..:.||.|||.||..:. :|:..:||.:.::|:||:||:..: 
  Fly    75 YFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNH-LARMVFEFIDGHTNMNHTCPYTKEK 138

  Fly   120 -LIVDKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTI 167
             :.:|.:....|:.::..: |.|:|.|.|.|.|....|.|.:...|:.:
  Fly   139 YISIDDLTNTEVSAKIRGV-PMPKGFYALFTTWSTENITRVVTNFYFEV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 27/108 (25%)
CG33914NP_001027394.2 DUF1091 85..166 CDD:284008 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472269
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.