DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33758

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:162 Identity:46/162 - (28%)
Similarity:76/162 - (46%) Gaps:22/162 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANR-------SYKY------LTL 60
            :.::...||:......:.:|.:|.|.:||:.|.:|..|.:::.:|       .||.      :.:
  Fly     2 LALLFFTLLVLTSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFI 66

  Fly    61 KVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPF----NHDLI 121
            ::..||  |.||:|||::|.|.:.|.||.. ::..|....|.:...|...|:||||    |..|.
  Fly    67 RLEFFK--RANGWRPFLYNFTANLCDFLAR-NNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLE 128

  Fly   122 VDKIPIDFVNHRVTNILPFPEGDYLLETHWIA 153
            .....:|..|.|  |..|...|:|.|:..:||
  Fly   129 CKDFELDINNLR--NRFPIETGEYALQLTFIA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 30/90 (33%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.