DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33777

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:172 Identity:77/172 - (44%)
Similarity:115/172 - (66%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP---- 68
            :::.:|..|.:.:      :|||::|||.|..|...::||::|.||:||||:|:|||.:.|    
  Fly     6 YLIQLLFFLFLVE------KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRI 64

  Fly    69 --------RFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKI 125
                    |:|||:|.::|.|:|||:|:||..|.|:|.|.|..|..|||:|::||||.|.||:|:
  Fly    65 KVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKL 129

  Fly   126 PIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTI 167
            ||.|||::||::||.|.||||..:||..|:|.|..:.:|.||
  Fly   130 PISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 49/98 (50%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 44/78 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472057
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.