DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33648

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:70/176 - (39%)
Similarity:111/176 - (63%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYL-------------- 58
            |:.:::|::|......|..||||::|:|.|.|:..:|.|.|:|.||:|||:              
  Fly     5 HLALMIVVILYGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNA 69

  Fly    59 TLKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNL-NHSCPFNHDLIV 122
            |:.|.|:|  |:|||:||::|:::||||||:...|..:.||.::.....||: :.:||||..:.|
  Fly    70 TINVALYK--RYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISV 132

  Fly   123 DKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            ||:..:|:|:::|.:||.||||||....|.:|.|.|:.|.:|.|||
  Fly   133 DKLTTNFLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNVYITIS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 38/87 (44%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472059
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.