DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33643

DIOPT Version :10

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:171 Identity:38/171 - (22%)
Similarity:65/171 - (38%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VILLMAKWASSKFEFT--NLQCTSFDKSFDDFEYCYI-RSANRSY----KYLTLKV------NLF 65
            :||.....|...|...  ::....||....:...|.: :|:||||    ..|..:|      |:.
  Fly    11 LILYCVDSAQRNFRIVVDHISTKIFDTKTIETLGCQVDQSSNRSYVNCHMLLNREVGKFDARNVL 75

  Fly    66 KTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCP----FNH---DLIVD 123
            ...|.||....::...||||..|.:.....:...:.:.|..:||:  .||    ||:   :|.:|
  Fly    76 DFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNV--ECPLKANFNYTMKNLYMD 138

  Fly   124 KIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIY 164
            :  .||.:.       .|.|.:            |::::.|
  Fly   139 E--QDFPSF-------VPSGTF------------RSLIEFY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 23/99 (23%)
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 21/95 (22%)

Return to query results.
Submit another query.