DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33796

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:167 Identity:54/167 - (32%)
Similarity:83/167 - (49%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVVILVILLMAKWASSK---FEFTNLQCTSFDKSFDDFEYCYIRSANR-------------SYKY 57
            |||.|.||.:.....|.   |:.||:.|.|::|::.....|.:::.||             ..|.
  Fly     7 IVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKS 71

  Fly    58 LTLKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKP---IAKYFYEFFNSYSNLNHSCPFNHD 119
            :|:....||  |.|||||::.|..:|.||||:    ||   :....:..:.:::|:||:||...|
  Fly    72 ITVHYQTFK--RENGYRPWLVNTQIDGCRFLR----KPYDALGILLFNIYRNFTNINHTCPLQGD 130

  Fly   120 LIVDKIPIDFVNHRVTNI--LPFPEGDYLLETHWIAY 154
            :||..:      :..|::  ||.|.|||||...||.|
  Fly   131 MIVRNM------YLTTDVMRLPLPTGDYLLAIDWIFY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 31/91 (34%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.