DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33920

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:175 Identity:103/175 - (58%)
Similarity:131/175 - (74%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP--- 68
            |.:|.:|.:.:.....||||||||:.|.|.||.|.|||||||:|.||||||:::|..|||||   
  Fly     6 CGLVALLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITK 70

  Fly    69 -------RF---NGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVD 123
                   ||   |||||||||||||||||:.||.|.|||.|.|:|...::|:||:||::|||:::
  Fly    71 INGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIE 135

  Fly   124 KIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168
            |:||.||||:||.:||.||||||.||:|:||:|.||:||:|.|||
  Fly   136 KLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTIS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 58/99 (59%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 51/86 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.150

Return to query results.
Submit another query.