DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG14492

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:52/136 - (38%) Gaps:39/136 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILVILLMAKW-----ASSKFEFTNLQCTSFDKSFDDFEYCYIR----SANRSYKYLT------- 59
            :::.:.|:..|     |.:.||   ||..:|..|.||.....::    ..::|.|..|       
  Fly    12 MVIFLYLLPNWKLEAEAKNNFE---LQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVL 73

  Fly    60 ----------LKVNLFKTPRFNGYRPF----MFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNL 110
                      :|:.|   ||   .||.    :.|:|.|.|:.|.|.:..|:.:........:||.
  Fly    74 EQPVAEHDFFIKIVL---PR---RRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNF 132

  Fly   111 NHSCPF 116
            ...|||
  Fly   133 PKQCPF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 18/61 (30%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.