DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33654 and CG33453

DIOPT Version :9

Sequence 1:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:170 Identity:53/170 - (31%)
Similarity:86/170 - (50%) Gaps:25/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILVILLMAKWASS--KFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYL-------------TL 60
            |.|..|.:....|.  ..:.||:.|.|.:||:..|.||.:::.:|:...|             :|
  Fly    10 VFLAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLHPTNNVSL 74

  Fly    61 KVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKI 125
            ::.:.|  |.:||:||:|::|:|||:||:...: |:.|.||.|...||.|||:||:...::.|  
  Fly    75 RLKMVK--RLSGYKPFLFDVTIDACQFLRKRHN-PVIKMFYSFIKDYSTLNHTCPYGLQVVSD-- 134

  Fly   126 PIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYY 165
                 .|.....:|.|.|||.:...:|.|...:..|.||:
  Fly   135 -----YHTAVFPVPLPSGDYGVLLDFIFYAKKQFHVNIYF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 33/86 (38%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472403
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.