DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33804 and H4f3

DIOPT Version :9

Sequence 1:NP_001027286.1 Gene:His1:CG33804 / 3771818 FlyBaseID:FBgn0053804 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038952068.1 Gene:H4f3 / 684828 RGDID:1585568 Length:220 Species:Rattus norvegicus


Alignment Length:257 Identity:99/257 - (38%)
Similarity:125/257 - (48%) Gaps:56/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ||::|.|..|:     ||.|||..|:|||..::....|:.:   |.||..:::..::...|||.|
  Rat     1 MSETAPAAPAA-----PAPVEKTPVKKKAKKTSSAAGKRKA---SGPPVSELITKAVAASKERSG 57

  Fly    66 SSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKA 129
            .||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||||||||:   ||....:|
  Rat    58 VSLAALKKALAAAGY--DVEKNNSRIKLGLKSLVSKGILVQTKGTGASGSFKLN---KKASSGEA 117

  Fly   130 KSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKT 194
            |.|              :||:|.:..|...|:|.|..||..:...:||   |||.| |||     
  Rat   118 KPK--------------AKKVGAAKAKKPAGSAKKPKKATGSATPRKT---KKTPK-KAK----- 159

  Fly   195 GIIKSKPAATK-AKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAK 255
                 ||.||. ||..:..||.|.|          |||||..|.   .|.||.||||.|..|
  Rat   160 -----KPGATAGAKKVSKSPKKVKA----------AKPKKAAKS---PAKAKAPKAKATKPK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33804NP_001027286.1 Linker_histone 46..118 CDD:278939 34/72 (47%)
H4f3XP_038952068.1 H15 35..115 CDD:238028 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4648
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X117
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.