DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33804 and Rbm43

DIOPT Version :9

Sequence 1:NP_001027286.1 Gene:His1:CG33804 / 3771818 FlyBaseID:FBgn0053804 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001032738.1 Gene:Rbm43 / 311020 RGDID:1306676 Length:343 Species:Rattus norvegicus


Alignment Length:265 Identity:48/265 - (18%)
Similarity:85/265 - (32%) Gaps:89/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPP------------ATVEKKVVQKKASGSAGT--KAKKASATPSHPPTQQ 51
            :|:..|..|..||....            ..|||.:...::.|.|..  |.||.:.|        
  Rat    12 VSERTVVVSGLPVGLSKDQLVKRYFRDEGGHVEKVIYPPRSKGVAYIIFKEKKVAQT-------- 68

  Fly    52 MVDASIKNLKERGGSS-LLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSF 115
                .|:..|...||. ||.:..:        ::|:..::...|..:|...:::           
  Rat    69 ----IIRQKKHSLGSEPLLTVSHF--------SEKVFNYVMAILDLSVFRPQIV----------- 110

  Fly   116 KLSASAKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATK--KTA 178
                         .:|.|:..:||:.:...:  .:|.|.|.:..|:.....|.|:|:.:|  ...
  Rat   111 -------------LESLVVDLKKKIPTLNFS--PLGRSGKISVQGSFLAILKLKQALISKAISAL 160

  Fly   179 ENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSAT 243
            ||.:                 |.|..:...|...|:.|:.|...:.|.:.         .||...
  Rat   161 ENNR-----------------KYAGERRNWTGQNPRRVLQKNENSAPTLG---------TSVPEP 199

  Fly   244 AKKPK 248
            |..|:
  Rat   200 AGSPE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33804NP_001027286.1 Linker_histone 46..118 CDD:278939 9/72 (13%)
Rbm43NP_001032738.1 RRM_SF 15..80 CDD:302621 16/76 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..200 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.