DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33816 and H1f1

DIOPT Version :9

Sequence 1:NP_001027304.1 Gene:His1:CG33816 / 3771816 FlyBaseID:FBgn0053816 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001099583.1 Gene:H1f1 / 291145 RGDID:1305706 Length:214 Species:Rattus norvegicus


Alignment Length:247 Identity:91/247 - (36%)
Similarity:118/247 - (47%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATV-EKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERG 64
            ||::|      ||..|.:.. ||....||....|  ||......|:.|...:::..::.:.|||.
  Rat     1 MSETA------PVPQPASVAPEKPAATKKTRKPA--KAAVPRKKPAGPSVSELIVQAVSSSKERS 57

  Fly    65 GSSLLAIKKYITAT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPK 128
            |.||.|:||.:.|. |  |.:|....||..|||.|..|.|:||||.||:|||||:          
  Rat    58 GVSLAALKKSLAAAGY--DVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLN---------- 110

  Fly   129 AKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKK-------TEKA 186
                     ||.:||...:|   |:.|..|.||| ||||.....|.|||.:..|       ::|.
  Rat   111 ---------KKAESKASTTK---VTVKAKASGAA-KKPKKTAGAAAKKTVKTPKKPKKPAVSKKT 162

  Fly   187 KAKDAKKTGIIKSKPAA-TKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
            .:|..||..::|:|..| :.||..|.||||  ||....||...|||||...|
  Rat   163 SSKSPKKPKVVKAKKVAKSPAKAKAVKPKA--AKVKVTKPKTPAKPKKAAPK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33816NP_001027304.1 Linker_histone 46..118 CDD:278939 32/72 (44%)
H1f1NP_001099583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 15/49 (31%)
H15 36..121 CDD:238028 38/105 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..214 57/145 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10170
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4648
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X117
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.