DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33816 and hil-3

DIOPT Version :9

Sequence 1:NP_001027304.1 Gene:His1:CG33816 / 3771816 FlyBaseID:FBgn0053816 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_509375.1 Gene:hil-3 / 181073 WormBaseID:WBGene00001854 Length:208 Species:Caenorhabditis elegans


Alignment Length:240 Identity:98/240 - (40%)
Similarity:122/240 - (50%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |||:.||::|  |.||..||      |....:..||..||....:|||...||.|:|..||||.|
 Worm     1 MSDTVVASAA--VQAPAKTV------KSPKAAKTTKVPKAKKPVAHPPYINMVTAAINGLKERKG 57

  Fly    66 SSLLAIKKYITATYKCDAQ--KLAPFIKKYLKSAVVNGKLIQTKGKGASGSF----KLSASAKKE 124
            ||.:||.||||..|....|  |:...::..|...||:..|:|:.|.||||.|    |.:|:||| 
 Worm    58 SSKIAILKYITKNYNVGDQIIKINARLRDTLNKGVVSKALVQSVGTGASGRFRVTEKKAAAAKK- 121

  Fly   125 KDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAK 189
              |.|| |..:.|||.: |.||        :|.|.|  :||.|...|..|||||:..|    |.|
 Worm   122 --PVAK-KAATGEKKAK-KPVA--------QKAATG--EKKAKKTTATKTKKTADKVK----KVK 168

  Fly   190 DAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKT 234
            ..||.    :||.|.|...:.|| |:...||:.||||..|...||
 Worm   169 SPKKI----AKPTAKKVAKSPAK-KSAPKKAAAAKPAKKAVAPKT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33816NP_001027304.1 Linker_histone 46..118 CDD:278939 35/77 (45%)
hil-3NP_509375.1 Linker_histone 38..111 CDD:278939 34/72 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6615
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm4774
orthoMCL 1 0.900 - - OOG6_110754
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.