DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33816 and H1f8

DIOPT Version :9

Sequence 1:NP_001027304.1 Gene:His1:CG33816 / 3771816 FlyBaseID:FBgn0053816 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_612184.1 Gene:H1f8 / 171506 MGIID:2176207 Length:304 Species:Mus musculus


Alignment Length:278 Identity:78/278 - (28%)
Similarity:119/278 - (42%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDSAVATSASPVAAPPATVEKKVVQKKASGSA--------GTKAKKASATPSHPPTQQMVDASIK 58
            |.|:|::|:.|..           ....|||.        |...::..|...:|....||..::|
Mouse     5 SVSSVSSSSFPSR-----------DTSPSGSCGLPGADKPGPSCRRIQAGQRNPTMLHMVLEALK 58

  Fly    59 NLKERGGSSLLAIKKYITATY-KCDAQKLAPFIKKYLKSAVVNGKLIQ---TKGKGASGSFKLSA 119
            ..:.|.|:|::|||.||...| ..|..:....:|:.|::.|..|.|.:   :|.|||:|||||. 
Mouse    59 AREARQGTSVVAIKVYIQHKYPTVDTTRFKYLLKQALETGVRRGLLTRPAHSKAKGATGSFKLV- 122

  Fly   120 SAKKEKDPKAKSKVLSAEK----KVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAEN 180
                   ||.|:|...|.|    ...:|:..|||.|: .||..||.|..:...|:.....|.|..
Mouse   123 -------PKPKTKKACAPKAGRGAAGAKETGSKKSGL-LKKDQVGKATMEKGQKRRAYPCKAATL 179

  Fly   181 K---KTEKAKAKDAKKTGIIKSKPAAT--------KAKVTAAKPKAVV---AKASKAKPAVSAKP 231
            :   |..|||.|:.:|..:.:.|.|..        |.|.:.::.:|..   .|..|:||..|.  
Mouse   180 EMAPKKAKAKPKEVRKAPLKQDKAAGAPLTANGGQKVKRSGSRQEANAHGKTKGEKSKPLASK-- 242

  Fly   232 KKTVKKASVSATAKKPKA 249
                .:.||::.||:..|
Mouse   243 ----VQNSVASLAKRKMA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33816NP_001027304.1 Linker_histone 46..118 CDD:278939 27/75 (36%)
H1f8NP_612184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 9/43 (21%)
H15 43..134 CDD:238028 33/98 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..248 45/152 (30%)
Nuclear localization signal. /evidence=ECO:0000255 154..170 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.