DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33816 and Hp1bp3

DIOPT Version :9

Sequence 1:NP_001027304.1 Gene:His1:CG33816 / 3771816 FlyBaseID:FBgn0053816 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006538629.1 Gene:Hp1bp3 / 15441 MGIID:109369 Length:580 Species:Mus musculus


Alignment Length:327 Identity:80/327 - (24%)
Similarity:124/327 - (37%) Gaps:100/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VEKKVVQKKASGS----------AGTKAKKASATPSHPPT--QQMVDASIKNLKERGGSSLLAIK 72
            |.::|..|.||||          ..:|.:|.||....|..  :.::..:...|.|...:|...|:
Mouse   244 VIRQVKGKGASGSFVVVQKSKPPQKSKNRKGSALDPEPQVKLEDVLPLAFTRLCEPKEASYSLIR 308

  Fly    73 KYITATYKCDAQKLAP-FIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKK------------- 123
            ||::..|......:.| .:|..|:.||..|:|.|..||||||:|:|..|.:|             
Mouse   309 KYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEYAIL 373

  Fly   124 ----------------------EKDPKAKS--------KVL-SAEKKVQSKKVASKKI------- 150
                                  |..|.|.|        |.| ..||....::::.|..       
Mouse   374 SAIAAMNEPKTCSTTALKKYVLENHPGANSNYQMHLLKKTLQKCEKNGWLEQISGKGFSGTFQLS 438

  Fly   151 -------GVSSKKTAVGAA-----------------DKKPKAKKAVATKKTAENK-KTEKAKAKD 190
                   ||...|...|.:                 |::|..|:::..|..|::: ||...|.:.
Mouse   439 FPYYPSPGVLFPKKESGGSDDEDEDDDDDESSEDSEDEEPPPKRSLQKKTPAKSQGKTASMKQRG 503

  Fly   191 AKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAK-PAVSAKPKKTVKKASVSATAKKPKAKTTAA 254
            :|..   :..|||.:.||.....||    ..||| ||..|:|..:|.|....::::||.|   :|
Mouse   504 SKPA---RKVPAAQRGKVRPLPKKA----PPKAKTPARKARPSPSVIKKPSGSSSRKPIA---SA 558

  Fly   255 KK 256
            :|
Mouse   559 RK 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33816NP_001027304.1 Linker_histone 46..118 CDD:278939 23/74 (31%)
Hp1bp3XP_006538629.1 PRK13108 <55..187 CDD:237284
H15 184..268 CDD:238028 7/23 (30%)
H15 279..345 CDD:197772 16/65 (25%)
Linker_histone 372..438 CDD:366156 9/65 (14%)
PRK13808 <481..580 CDD:172341 28/90 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.