DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33852 and h1-0

DIOPT Version :9

Sequence 1:NP_001027364.1 Gene:His1:CG33852 / 3771803 FlyBaseID:FBgn0053852 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_955846.1 Gene:h1-0 / 321618 ZFINID:ZDB-GENE-030131-337 Length:199 Species:Danio rerio


Alignment Length:245 Identity:89/245 - (36%)
Similarity:113/245 - (46%) Gaps:56/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIK 72
            |:|:|.:.|                  .:||.:....|||...:|:.|:|...:.|||:|..:|:
Zfish     4 TAATPSSKP------------------KRAKSSKKGTSHPKYSEMIKAAIAADRSRGGASRQSIQ 50

  Fly    73 KYITATYK----CDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKV 133
            ||:...||    .|:|     ||..||..|..|.|..|||.||||||||:.:...:|..|.|...
Zfish    51 KYVKHHYKVGDNADSQ-----IKLALKRLVAGGDLRHTKGIGASGSFKLAKAEDIKKPEKPKPAA 110

  Fly   134 LSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDA--KKTGI 196
            ..|.|.|   |.|:|             ..|.||.||  .||..|:.||..:.|.|.|  ||...
Zfish   111 AKARKPV---KAAAK-------------PKKAPKPKK--VTKSPAKTKKAAEKKVKKAAEKKKSP 157

  Fly   197 IKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKK 246
            :|:|....||||  |||    |||||||...:||||   .|.:...|.||
Zfish   158 VKAKKVVKKAKV--AKP----AKASKAKKVKTAKPK---PKTAARKTGKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33852NP_001027364.1 Linker_histone 46..118 CDD:278939 33/75 (44%)
h1-0NP_955846.1 Linker_histone 24..95 CDD:366156 33/75 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4847
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm6549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2142
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.