DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG34260

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:79 Identity:21/79 - (26%)
Similarity:39/79 - (49%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDYTFDGCKFLRN--QKHPIIKLFY 107
            ::|:|.::.||..            :|.|::.|.. :....|...||||:|.:  |.:.:.|||.
  Fly    60 SLNQTIEHFDVLA------------TFDLIKKDKS-RMNIADIKIDGCKYLGSMYQNNIVGKLFK 111

  Fly   108 KIYQGSSNINHTCP 121
            :: :..||:..:||
  Fly   112 RL-KSVSNLPDSCP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 16/51 (31%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.