DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG14518

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:152 Identity:44/152 - (28%)
Similarity:86/152 - (56%) Gaps:5/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDYT 88
            ||..|.:.:.::..|..|.::||:|....::|..||.. |:.::.:..||::..:||||:....:
  Fly    28 TNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWLYSVS 91

  Fly    89 FDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAV 153
            ||||:|:|.:.:.:|::.:::::..|.|||||||   :.:..:....:.|:.|. .|:..|:|.:
  Fly    92 FDGCQFIRRRNNALIRIVWELFKEYSTINHTCPY---VGLQQVKNFYLRSEKLP-TPIPTGEYLL 152

  Fly   154 YSNWSTDNIMRAYLNLYFRVTE 175
            ..:|..:...:|..|:||...|
  Fly   153 MIDWVFNKKPQAATNVYFTFVE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 25/79 (32%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.060

Return to query results.
Submit another query.