DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG13589

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:183 Identity:54/183 - (29%)
Similarity:89/183 - (48%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RRLFNVFIIMGSLMAIHTHMT-FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPID 65
            |..|.|.:|:|.|:.....:. .||..|.|.:.::.:...|.:||.:||...:::.....: |..
  Fly     5 RAAFVVSVILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAK 68

  Fly    66 NITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYD------- 123
            ||.:..::|:..:|||||..|||||.|:|:|.:..|..|:.:.:.:..|.:||||||:       
  Fly    69 NIYLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSD 133

  Fly   124 -HDIIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVTE 175
             |.|.|.              :|:.:|||.:..:|..|...:...|:||...|
  Fly   134 FHHIDVP--------------VPLPSGDYLLLLDWIFDFKPQFATNVYFTFVE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 30/87 (34%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.