DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33690

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:162 Identity:78/162 - (48%)
Similarity:116/162 - (71%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHG 79
            |....|:||||:.|.|.:..|..|..|.||||||||||:.:|..|.::||.:..::.:..|.|.|
  Fly    15 MICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQFRRFDSG 79

  Fly    80 YKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYI 144
            ||||..|.::|||||::.||:.::|.||:.:|.::|||||||||||:|||.|:|||:|.:|.::|
  Fly    80 YKPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTGNLEEEFGRFI 144

  Fly   145 PMINGDYAVYSNWSTDNIMRAYLNLYFRVTER 176
            .:.|||||:|::|:|:.|.||.:.:|.::..|
  Fly   145 IIPNGDYAIYTDWATNKISRASVKIYLKILNR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 44/79 (56%)
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 44/79 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111146at33392
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.020

Return to query results.
Submit another query.