DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33679

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:180 Identity:51/180 - (28%)
Similarity:90/180 - (50%) Gaps:26/180 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FIIMGSLMAI---HTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITI 69
            :::..||:.|   |.::..||:||.|.|.:|.:|.:|.:|.:.|.....:::|.|.||||:.:.:
  Fly     3 YLLWISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVV 67

  Fly    70 SFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHP----IIKLFYKIYQGSSNINHTCPYDHDIIVDH 130
            .|...|..:||.||..:.:.:.|:.||   :|    :...||..:...|||||||||:.||.:.:
  Fly    68 RFITYRKLNGYHPFLFNVSEEHCRVLR---YPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRN 129

  Fly   131 LWTGNIESDFLKYIPMINGDYAV-------YSNWSTDNIMRAYLNLYFRV 173
            .   .::......:|:..|.|.:       ..||.      :.:|::|.:
  Fly   130 C---TLDDRMFAKVPLPKGSYKLTLEMDDGVVNWI------SIINIHFEI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 25/83 (30%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.