DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33723

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster


Alignment Length:172 Identity:61/172 - (35%)
Similarity:107/172 - (62%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNIT 68
            |.::.::|..:..|...:.|||:||.|.:..||.|.:|.:|::|||:||:...|:|:||||....
  Fly     9 LVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKAR 73

  Fly    69 ISFRLMRHDHGYKPFFIDYTFDGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLW 132
            ::|.|.:..:||:||..:.|.|.|.|.::|| :|:.|.|:.:.:..||:||:|||::||||:.:.
  Fly    74 VNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPYNNDIIVEKVS 138

  Fly   133 TGNIESDFLKYIPMINGDYAVYSNWSTDNI----MRAYLNLY 170
            |..:.....|.:|...|||.:.::|..::|    ::.|:.|:
  Fly   139 TDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITLF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 31/80 (39%)
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 32/84 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.