DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33928

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:178 Identity:74/178 - (41%)
Similarity:106/178 - (59%) Gaps:8/178 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FNVFIIMGSL--MAIHTHMT------FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYK 61
            |....|.|.:  |....|:.      ||||||.|.|..|:.|:.||:||.|||:||:.|.|.|||
  Fly     3 FQCITIAGVIYFMFFQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYK 67

  Fly    62 LPIDNITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDI 126
            :|:.:.|::..|.:..:|..||..::||||||.:.|..:|::...:.:::..|||||:|||.|||
  Fly    68 IPVHHFTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDI 132

  Fly   127 IVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVT 174
            |||.|.|..:...|.||:|:..|||...|||.|:...||.:.::|..|
  Fly   133 IVDKLPTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSFT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 35/79 (44%)
CG33928NP_001027276.1 DUF1091 75..159 CDD:284008 35/83 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.