DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33928

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027276.1 Gene:CG33928 / 3772334 FlyBaseID:FBgn0053928 Length:180 Species:Drosophila melanogaster


Alignment Length:178 Identity:74/178 - (41%)
Similarity:106/178 - (59%) Gaps:8/178 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FNVFIIMGSL--MAIHTHMT------FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYK 61
            |....|.|.:  |....|:.      ||||||.|.|..|:.|:.||:||.|||:||:.|.|.|||
  Fly     3 FQCITIAGVIYFMFFQMHLVESSRIEFTNIKCTSMDKKFSDFEYCFLKATNRTYKYLSVKVRLYK 67

  Fly    62 LPIDNITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDI 126
            :|:.:.|::..|.:..:|..||..::||||||.:.|..:|::...:.:::..|||||:|||.|||
  Fly    68 IPVHHFTVNLGLHKRSNGLMPFNQNFTFDGCKMVANVGNPMVLFLFALFKPYSNINHSCPYTHDI 132

  Fly   127 IVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVT 174
            |||.|.|..:...|.||:|:..|||...|||.|:...||.:.::|..|
  Fly   133 IVDKLPTHFVNQQFTKYVPLPEGDYVFNSNWFTNGKNRAIVRVHFSFT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 35/79 (44%)
CG33928NP_001027276.1 DUF1091 81..159 CDD:461928 34/77 (44%)

Return to query results.
Submit another query.