DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33777

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:171 Identity:60/171 - (35%)
Similarity:100/171 - (58%) Gaps:11/171 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNIT 68
            ||.:|::          ..||||||.|.||.||....|::|:||||:||:.:.|||.:.|:..|.
  Fly    11 LFFLFLV----------EKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIK 65

  Fly    69 ISFRLMRHDHGYKPFFIDYTFDGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLW 132
            ::....:..:||||...::|.|.|||::|.| :|:....|::::..||:|:|||::.|.||:.|.
  Fly    66 VNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKLP 130

  Fly   133 TGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRV 173
            ...:.:.....:|:.:|||...|:|...:|.|..:|:|..:
  Fly   131 ISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 27/80 (34%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.