DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33648

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:154 Identity:59/154 - (38%)
Similarity:92/154 - (59%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDY 87
            ||||||.|.|.::..::.|.||:||||:||:.|...|..||:.|.||:..|.:..:|||||..:.
  Fly    25 FTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINVALYKRYNGYKPFLYNV 89

  Fly    88 TFDGCKFLRNQK-HPIIKLFYKIYQGSSNI-NHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGD 150
            :.|.|:|||.|| :.::|..:.:....||| :.|||::..|.||.|.|..:.:...:.:|:..||
  Fly    90 SVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLTQVLPVPEGD 154

  Fly   151 YAVYSNWSTDNIMRAYLNLYFRVT 174
            |.....|.:.||.|:.:|:|..::
  Fly   155 YLFAFRWFSYNIYRSSVNVYITIS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 29/81 (36%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 30/85 (35%)

Return to query results.
Submit another query.