DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33688

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:174 Identity:97/174 - (55%)
Similarity:135/174 - (77%) Gaps:1/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRRLFNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPID 65
            ||..|.:.||:|.|..:..|:||||:|||.:......|:|||||||||||||:|:||||::..::
  Fly     1 MRVFFLILIILGYLATVFNHVTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVN 65

  Fly    66 NITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDH 130
            |:|: .:||||::||||||:|.|.|.||||::.:..|||..|.||:.:|||||||||...:||.|
  Fly    66 NVTV-IKLMRHNNGYKPFFVDVTIDVCKFLKDPRQSIIKKLYDIYKNNSNINHTCPYKDVVIVHH 129

  Fly   131 LWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVT 174
            |||||:||||:||:|:|:||||:|:.||..|:.||::::|.||:
  Fly   130 LWTGNLESDFMKYLPLIDGDYAIYTEWSVYNVARAFIDVYIRVS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 51/79 (65%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 51/79 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446120
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111146at33392
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.