DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33641

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:91 Identity:27/91 - (29%)
Similarity:43/91 - (47%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IFKK--C-FIKAVNRTHKYVDVYVNLYKLPID-NITISFRLMRHDHGYKPFFIDYTFDGCKFLRN 97
            ||:|  | ..:|.||:  ||:|.:.|.|...| |:.......:.:...|....|...|||..||.
  Fly    40 IFEKMDCNLYQANNRS--YVNVEMKLKKEVSDLNVRAIMEFWKPNAQNKMKLYDVRVDGCLILRT 102

  Fly    98 -QKHPIIKLFYKIYQGSSNINHTCPY 122
             .|:.:...:.|.::..||:..:||:
  Fly   103 IHKNKLFYFYVKSFKKHSNVVLSCPF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 13/51 (25%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:461928 13/49 (27%)

Return to query results.
Submit another query.