DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33922

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:172 Identity:65/172 - (37%)
Similarity:108/172 - (62%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLFNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNI 67
            ||..:.|.:.::..:...:.||||||.:.||.||:|..||:|:||||:||..:.|.|.|.|:.|:
  Fly     6 RLVQLSIFLFTIHLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNV 70

  Fly    68 TISFRLMRHDHGYKPFFIDYTFDGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHL 131
            .|:....:..:|||||..:.|.|||:|.::|: :|:...|:..::..|||||:||||||||:|.:
  Fly    71 KINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILDKV 135

  Fly   132 WTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRV 173
            ...:..:.....:|:.:|:|...::|...||.||.:::|.::
  Fly   136 SISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVYAKI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 30/80 (38%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 30/83 (36%)

Return to query results.
Submit another query.