DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33645

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster


Alignment Length:173 Identity:38/173 - (21%)
Similarity:75/173 - (43%) Gaps:29/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVY------------------VNLY 60
            |:.....:.|.:::|  ::..|.:    :||.||.||...|:|                  |:::
  Fly     5 LLFFSATLIFNSMRC--EERNFRV----YIKEVNITHLDTDLYEKFECKVYQVDNRTYMDSVHIF 63

  Fly    61 KLPIDNITISFRL--MRHDHGYKPFFIDYTFDGCKFLRN-QKHPIIKLFYKIYQGSSNINHTCPY 122
            |..:|:||:...|  .:.:...|....|..|:||..|.| .|:.:..::.:..:..||:...||:
  Fly    64 KRTVDDITVHAALDFWKLNSKQKMKLYDVQFNGCYILENANKNRLFNMYVQNLKKHSNVKFKCPF 128

  Fly   123 DHDIIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIMRA 165
            ..::..:.......|.||..::|:  |.:.....:.|:..:||
  Fly   129 RANVSYEVKNLTMSEQDFPSFVPL--GKFRSLIEYCTNQKLRA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 18/82 (22%)
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.