DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33927

DIOPT Version :10

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:174 Identity:43/174 - (24%)
Similarity:81/174 - (46%) Gaps:7/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITI 69
            |.:.:.:||:.|  :...|||..|.|.:.|:....:|.:||:.|....:.....:.| .|....:
  Fly    14 FRIALELGSINA--SRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK-TISKFRV 75

  Fly    70 SFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTG 134
            ..::.:..:|:||:..:.|||||:|||......:.:.:.:.:..||:|.||||...:   |:...
  Fly    76 HGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPV---HIMGL 137

  Fly   135 NIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVTERHS 178
            :|..:.:. :|:..|:|.:...|.....:.....:.|...|..|
  Fly   138 HIIGEQIP-VPLPTGEYLIQIKWYISKTLFLSTGIKFAFEENFS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 23/79 (29%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 23/83 (28%)

Return to query results.
Submit another query.