DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33927

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:174 Identity:43/174 - (24%)
Similarity:81/174 - (46%) Gaps:7/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FNVFIIMGSLMAIHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITI 69
            |.:.:.:||:.|  :...|||..|.|.:.|:....:|.:||:.|....:.....:.| .|....:
  Fly    14 FRIALELGSINA--SRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK-TISKFRV 75

  Fly    70 SFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTG 134
            ..::.:..:|:||:..:.|||||:|||......:.:.:.:.:..||:|.||||...:   |:...
  Fly    76 HGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPV---HIMGL 137

  Fly   135 NIESDFLKYIPMINGDYAVYSNWSTDNIMRAYLNLYFRVTERHS 178
            :|..:.:. :|:..|:|.:...|.....:.....:.|...|..|
  Fly   138 HIIGEQIP-VPLPTGEYLIQIKWYISKTLFLSTGIKFAFEENFS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 23/79 (29%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.060

Return to query results.
Submit another query.