DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33654

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:176 Identity:63/176 - (35%)
Similarity:100/176 - (56%) Gaps:25/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFIIMGSLMA--IHTHMTFTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITI 69
            |.|::..|||  ..:...|||::|.|.|.:|..|:.|:|::.||::||:.:.|||:|.|..|   
  Fly    10 VVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTPRFN--- 71

  Fly    70 SFRLMRHDHGYKPFFIDYTFDGCKFLRN-QKHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWT 133
                     ||:||..:.|.|.|:||:| ...||.|.||:.:...||:||:||::||:|||    
  Fly    72 ---------GYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVD---- 123

  Fly   134 GNIESDFLKY-----IPMINGDYAVYSNWSTDNIMRAYLNLYFRVT 174
             .|..||:.:     :|...|||.:.::|....|.||.:.:|:.::
  Fly   124 -KIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYYTIS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 33/85 (39%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 39/103 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.