DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33642

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:168 Identity:34/168 - (20%)
Similarity:72/168 - (42%) Gaps:42/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FTN---IKCGSKDPTFAIFKKCF--------------IKAVNRTHKYVDVYVN---LYKLPIDNI 67
            |||   :||  ::.:|.|....|              .:.||..::   .|||   :.|..:::|
  Fly    15 FTNHICLKC--EERSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNR---SYVNGEMIVKSDVEDI 74

  Fly    68 ----TISFRLMRHDHGYKPFFIDYTFDGCKFLR-NQKHPIIKLFYKIYQGSSNINHTCP----YD 123
                |:.|....:....|.:  |...|.|:||: :.::.:.|::.|.::...:.|.:||    ::
  Fly    75 LMHTTMDFWKTSNQKKIKLY--DGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFN 137

  Fly   124 HDIIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDN 161
            :.:...|:    .|.|...::|:  |.:...:.:.|.:
  Fly   138 YTLTNWHM----DEKDLPPFVPL--GTFRTVTEYFTQD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 16/84 (19%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.