DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33689 and CG33483

DIOPT Version :9

Sequence 1:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:153 Identity:64/153 - (41%)
Similarity:97/153 - (63%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDY 87
            ||||||.|.|..|..|:.|.:|:|||:.||:.:.|||:|:||..:.::|.|::..:|||||..:.
  Fly    77 FTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLYNI 141

  Fly    88 TFDGCKFLRNQKH-PIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDY 151
            |.|.||.||:.|: ||...||.:::..||:|||||:|||:||:.|.|..:.......|...:|||
  Fly   142 TVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKFPHGDY 206

  Fly   152 AVYSNWSTDNIMRAYLNLYFRVT 174
            ..:|:|....|.||.::.:..::
  Fly   207 LFHSDWYAYGINRATVDFFLTLS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 35/80 (44%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.