DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33826 and HTZ1

DIOPT Version :9

Sequence 1:NP_001027321.1 Gene:His2A:CG33826 / 3771785 FlyBaseID:FBgn0053826 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_014631.1 Gene:HTZ1 / 854150 SGDID:S000005372 Length:134 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:79/132 - (59%)
Similarity:88/132 - (66%) Gaps:11/132 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAK--------SRSNRAGLQFPVGRIHRLL-RKGNYAERVGAGAPVYLAAVME 56
            |||:..|||.|..||        |.|.|||||||||||.|.| |......|||:.|.:||.||:|
Yeast     1 MSGKAHGGKGKSGAKDSGSLRSQSSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLE 65

  Fly    57 YLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            ||.|||||||||||:|.|..||.|||||||||.|:||:.|:. .|||.|||||:|...|| .|.|
Yeast    66 YLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIR-ATIASGGVLPHINKALL-LKVE 128

  Fly   122 KK 123
            ||
Yeast   129 KK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33826NP_001027321.1 PTZ00017 16..124 CDD:185399 70/109 (64%)
HTZ1NP_014631.1 PTZ00017 7..134 CDD:185399 76/126 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.